SEG output appended by default
Note: comments marked by "## COMMENT: "
The following information has been received by the server:
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ________________________________________________________________________________ return concise phdacc test seq from phd people run prodom #1ppt.pir ( 1ppt.hssp from: 1 to: 36 ) MPPRWASLLL LACSLLLLAV PPGTAGPSQP TYPGDDAPVE DLIRFYNDLQ QYLNVVTRHR YGRRSSSRVL CEEPMGAAGC ________________________________________________________________________________Result of SEG search (Amos Bairoch):
Result of SEG low-complexity search (JC Wootton & S Federhen):
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
please quote: J C Wootton & S Federhen: Analysis of compositionally
biased regions in sequence databases. Meth. in Enzymol.
1996, 266, 554-571.
NOTE 1: regions of low-complexity ('simple sequence' or 'compo-
sition biased regions') are marked by the letter 'x' in
the following output.
NOTE 2: The dynamic programming algorithm (MaxHom) does NOT take
the SEG information into account, nor do the PHD pre-
dictions!
!!! --> !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! <-- !!!
!!! --> WE STRONGLY suggest that you resubmit the regions NOT marked by <-- !!!
!!! --> 'x' separately!! <-- !!!
!!! --> !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! <-- !!!
________________________________________________________________________________
>prot , (#) ppOld,1ppt.pir ( 1ppt.hssp from: 1 to: 36 ) t1
MPPRWxxxxxxxxxxxxxxVPPGTAGPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHR
YGRRSSSRVLCEEPMGAAGC