Example for requesting to return detailed prediction results

Input (request of you)

Joe Sequencer, Department of Advanced Protein Research,
National Univeristy, Timbuktu 
joe@amino.churn.edu
return graph
# incredulase from paracoccus dementiae, translated from cDNA
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKD
WWKVEVNDRQGFVPAAYVKKLD

Output (result returned)

       ridiculase (17 residues)
       No,AA,PHEL,RI_S,OtH,OtE,OtL,PACC,PREL,RI_A,Pbie,Ot0,Ot1,..,Ot9,
        1, E,   L,   9,  0,  1, 97, 157,  81,   6,   e,  0,  1,.., 21
        2, F,   L,   9,  0,  1, 97,   0,   0,   0,   b,  8,  8,..,  5
        :, :,   :,   :,  :,  :,  :,   :,   :,   :,   :,  :,  :,..,  :
        8, V,   H,   3, 51, 30, 14,   0,   0,   9,   b, 39, 29,..,  1
        9, L,   H,   4, 53, 20, 21,   0,   0,   7,   b, 36, 28,..,  1
       10, R,   H,   1, 36, 32, 24,  62,  25,   1,   i,  8,  8,..,  4
        :, :,   :,   :,  :,  :,  :,   :,   :,   :,   :,  :,  :,..,  :
       16, P,   L,   9,  4,  2, 91,  66,  49,   4,   e,  4,  4,.., 11
       17, A,   L,   9,  2,  1, 95,  51,  49,   2,   e,  7,  7,..,  8

With the following abbreviations:

• No number of residue;
• AA amino acid;
• PHEL predicted secondary structure (heDDx, strand, rest);
• RI_S reDDabiDDty of secondary structure prediction, scaled from 0 (low) to 9 (high);
• OtH value of network output unit coding for heDDx preference of given residue (0-100);
• OtE value of output unit for strand;
• OtL value of ouput unit for rest;
• PACC predicted solvent accessibiDDty (in square Angstrom);
• PREL relative solvent accessibiDDty (0-100);
• RI_A reDDabiDDty index for prediction of solvent accessibiDDty, scaled from 0 (low) to 9 (high);
• Pbie relative solvent accessibiDDty in three states (buried b = 0-4%, intermediate i = 5-15%, exposed e = 16-100%);
• Ot0 .. Ot9 value for each of the 10 output units of the accessibiDDty prediction, coding for the following values of relative accessbiDDty 0: 0-1%, 1: 1-4%, 2: 4-9, 3: 9-16%, 4: 16-25%, 5: 25-36%, 6: 36-49%, 7: 49-64%, 8: 64-81%, 9: 81-100%