SERVERNAME: frsvr_SDPMA2 TARGET: T0055 PARAMETERS: excludefolds: 1kja 1hli include h3p2 URL: http://www.cs.bgu.ac.il/~dfischer/cafasp1/frsvr_SDPMA2.t0055 SERVER'S URL: http://www.doe-mbi.ucla.edu/people/frsvr/submit.html RANK FOLD SCORE LENGTH_ALIGNMENT SEQ_ID% 1 1esl 17.91 118 25 2 2msbb 10.65 112 18 3 1msba 10.45 113 18 4 1lit 9.69 119 20 5 1rtm2 8.81 112 19 6 1ixxb 8.25 112 25 7 1ixxa 6.29 108 26 8 1htn 5.39 117 18 9 1wkt 2.72 56 23 10 1bec_118-246 2.61 82 21 11 9rnt 2.15 94 19 12 3ebx 2.12 53 32 13 1prtb_4-87 1.91 82 17 14 1rtu 1.87 104 12 15 1a63 1.80 101 17 END The following are additional results for your prediction obtained using a multiple alignment of sequences homologous to your submitted sequence. The sequences in the multiple alignment (in addition to your sequence) are: lecc_polmi lem2_pig This method (MULT2+gonnet+predss) is still under testing. Comparing the results of the predictions for the homologous sequences may provide further information. You can obtain these by submitting them to this server. The three-dimensional fold predicted for your amino acid sequence is in the table below. HERE I INCLUDE ONLY THE RESULTS OF THE MULT2+gonnet+predss METHOD. THE OTHER RESULTS CAN BE FOUND AT THE URL (www page) SPECIFIED AT THE END OF THIS MESSAGE. Please cite: Fischer, D. and Eisenberg, D. Fold Recognition Using Sequence-Derived Predictions. Protein Science, 5, 947-955, 1996. Your sequence was translated to: seq.seq Length: 125 December 21, 1998 08:33 Type: P Check: 7777 .. 1 MDYEILFSDE TMNYADAGTY CQSRGMALVS SAMRDSTMVK AILAFTEVKG 51 HDYWVGADNL QDGAYNFLWN DGVSLPTDSD LWSPNEPSNP QSWQLCVQIW 101 SKYNLLDDVG CGGARRVICE KELDD NAME: t0055 FROM: dfischer@indigo.cs.bgu.ac.il BY YOUR REQUEST I HAVE NOT USED THE FOLLOWING FOLDS: 1hli 1kja The method used for this prediction was: MULT2+gonnet+predss . Most similar fold: 1esl E-SELECTIN (LECTIN AND EGF DOMAINS, RESIDUES 1 - 2 (FORMERLY KNOWN AS ELAM-1) RANK Z-SCORE FOLD LENGTHALI %ID 1 17.91 1esl 118 25 99--4-77--7-10 [(a+b) ; C-type lectin] [small ; EGF-like module] [MULTIDOMAIN ; ] 99--4-77--7-10 [(a+b) ; C-type lectin] [small ; EGF-like module] 2 10.65 2msbb 112 18 4-77 (a+b) ; C-type lectin] 4-77-1-1-2-2-1- 3 10.45 1msba 113 18 4-77 (a+b) ; C-type lectin] 4-77-1-1-2-2-13- 4 9.69 1lit 119 20 1997 new ; HUMAN LITHOSTATHI 5 8.81 1rtm2 112 19 99--4-77 [(a+b) ; C-type lectin] [MULTIDOMAIN ; ] 99--4-77 [(a+b) ; C-type lectin] 6 8.25 1ixxb 112 25 1998 7 6.29 1ixxa 108 26 1998 8 5.39 1htn 117 18 1998 9 2.72 1wkt 56 23 1997 new ; WILLIOPSIS MRAKII KILLER TOXIN, NMR SOLUTION STRUCTU 10 2.61 1bec_118-246 82 21 2-1 beta ; Immunoglobulin-like beta-sandwich] 2-1-1-2-1-1-1- 11 2.15 9rnt 94 19 4-1 (a+b) ; Microbal ribonucleases] 4-1-1-1-2-1- 12 2.12 3ebx 53 32 7-5 small ; Snake toxin-like] 7-5-1-1-1-1- 13 1.91 1prtb_4-87 82 17 4-77 (a+b) ; C-type lectin] 4-77-2-1-1-1-1- 14 1.87 1rtu 104 12 1997 new ; USTILAGO SPHAEROGENA RIBONUCLEASE 15 1.80 1a63 101 17 1998 LEGEND: COL. 1: RANK. The ranks are obtained by sorting the fold library, by Z-SCORES, in decreasing order. Only the 15 structures that are most compatible to your sequence are shown. COL. 2: Z-SCORE. The z-scores are computed using the distribution of raw scores (not shown) of all folds. COL. 3: FOLD. Protein Data Bank codes for the coordinates of the 3D structures. COL. 4: LENGTHALI. The number of residues from your sequence that were aligned to the fold. COL. 5: % ID. Percentage of identical residues in the alignment. RELIABILITY OF THIS PREDICTION: With this method the confidence threshold is a z-score of 5.0 +- 1.0. YOUR HIGHEST SCORING FOLD IS ABOVE THIS THRESHOLD Additional information for your prediction can be found at the url: http://www.mbi.ucla.edu/people/frsvr/preds/24402t0055 Below is the alignment of your sequence with the top hit structure. In the near future, all the alignments in a more readable format will be made available. bbbbbb hhhhhhhbbbbhhhhhhhhhhhhhhhhhbbbbbbb YEILFSDETMNYADAGTYCQSRGMALVSSAMRDSTMVKAILAFTEVKGHD | | | | | ||| | || | WSYNTSTEAMTYDEASAYCQQRYTHLV..AIQNKEEIEYLNSILSYSPSY bbbbb hhhhhhhhhhhhh bbb hhhhhhhhhhhh b bbbbbb bbbbb b bb bbb YWVGADNLQDGAYNFLW.NDGVSLPTDSDLWSPNEPSNPQSWQLCVQIWS || | | | | | || | | || | YWIGIRKVNN...VWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYI bbbbbbbb bbbbb bbb bbbbb bb bbbbbbbbb KYN....LLDDVGCGGARRVICEKELDD | | | | KREKDVGMWNDERCSKKKLALCYTAACT bbbbb bbbbbb 25%