SERVERNAME: frsvr_SDPMA TARGET: T0074 PARAMETERS: excludefolds: 1an3b 1az7 1bd9a 1bg8a 1bl0a 1cdaa 1hli 1illg 1ilma 1kja 2hie include h3p2 URL: http://www.cs.bgu.ac.il/~dfischer/cafasp1/frsvr_SDPMA.t0074 SERVER'S URL: http://www.doe-mbi.ucla.edu/people/frsvr/submit.html RANK FOLD SCORE LENGTH_ALIGNMENT SEQ_ID% 1 4icb 4.91 69 20 2 3ctn 4.80 73 21 3 1trf 4.73 73 26 4 1trca 3.86 65 25 5 1syma 2.85 80 23 6 1cnpa 2.64 79 10 7 5pal 2.58 72 28 8 1gg2g 2.56 54 19 9 1hcra 2.54 52 8 10 1adr 2.40 62 23 11 1fc2c 2.37 43 9 12 1fwp 2.31 64 13 13 1dipa 2.30 68 21 14 1dsba_65-128 2.28 47 11 15 1coo 2.18 78 17 END This method (MULT+gonnet+predss) is still under testing. Comparing the results of the predictions for the homologous sequences may provide further information. You can obtain these by submitting them to this server. The three-dimensional fold predicted for your amino acid sequence is in the table below. HERE I INCLUDE ONLY THE RESULTS OF THE MULT+gonnet+predss METHOD. THE OTHER RESULTS CAN BE FOUND AT THE URL (www page) SPECIFIED AT THE END OF THIS MESSAGE. Please cite: Fischer, D. and Eisenberg, D. Fold Recognition Using Sequence-Derived Predictions. Protein Science, 5, 947-955, 1996. Your sequence was translated to: seq.seq Length: 98 January 19, 1999 09:25 Type: P Check: 2844 .. 1 PWAVKPEDKA KYDAIFDSLS PVNGFLSGDK VKPVLLNSKL PVDILGRVWE 51 LSDIDHDGML DRDEFAVAMF LVYCALEKEP VPMSLPPALV PPSKRKTW NAME: t0074 FROM: dfischer@indigo.cs.bgu.ac.il BY YOUR REQUEST I HAVE NOT USED THE FOLLOWING FOLDS: 1an3b 1az7 1bd9a 1bg8a 1bl0a 1cdaa 1hli 1illg 1kja 2hie The method used for this prediction was: MULT+gonnet+predss . Most similar fold: 4icb CALBINDIN D9K (MINOR A FORM) RANK Z-SCORE FOLD LENGTHALI %ID 1 4.91 4icb 69 20 1-28 alpha ; EF-hand] 1-28-1-1-1-1- 2 4.80 3ctn 73 21 1998 3 4.73 1trf 73 26 1-28 alpha ; EF-hand] 1-28-1-5-1-2- 4 3.86 1trca 65 25 1-28 alpha ; EF-hand] 1-28-1-5-4-2-4- 5 2.85 1syma 80 23 1997 new ; 3-D SOLUTION STRUCTURE OF REDUCED APO-S100B FROM RAT, NM 6 2.64 1cnpa 79 10 1997 new ; THE STRUCTURE OF CALCYCLIN REVEALS A NOVEL HOMODIMERIC FO 7 2.58 5pal 72 28 1-28 alpha ; EF-hand] 1-28-1-4-2-3- 8 2.56 1gg2g 54 19 1997 new ; G PROTEIN HETEROTRIMER MUTANT GI_ALPHA_1(G203A) BETA 9 2.54 1hcra 52 8 1-4 alpha ; DNA-binding 3-helical bundle] 1-4-1-2-1-1-1- 10 2.40 1adr 62 23 1-25 alpha ; lambda repressor-like DNA-binding domains] 1-25-1-2-4-1- 11 2.37 1fc2c 43 9 1-8 alpha ; Immunoglobulin-binding protein A, fragment B] 1-8-1-1-1-1-1- 12 2.31 1fwp 64 13 1997 new ; CHEY-BINDING DOMAIN OF CHEA (RESIDUES 159 - 227), NM 13 2.30 1dipa 68 21 1997 new ; THE SOLUTION STRUCTURE OF PORCINE DELTA-SLEEP-INDU 14 2.28 1dsba_65-128 47 11 1-30 alpha ; Disulphide-bond formation facilitator (DSBA), insertion domain] 1-30-1-1-1-1-1- 15 2.18 1coo 78 17 1-26 alpha ; the C-terminal domain of RNA polymerase alpha subunit] 1-26-1-1-1-1- LEGEND: COL. 1: RANK. The ranks are obtained by sorting the fold library, by Z-SCORES, in decreasing order. Only the 15 structures that are most compatible to your sequence are shown. COL. 2: Z-SCORE. The z-scores are computed using the distribution of raw scores (not shown) of all folds. COL. 3: FOLD. Protein Data Bank codes for the coordinates of the 3D structures. COL. 4: LENGTHALI. The number of residues from your sequence that were aligned to the fold. COL. 5: % ID. Percentage of identical residues in the alignment. RELIABILITY OF THIS PREDICTION: With this method the confidence threshold is a z-score of 5.0 +- 1.0. YOUR HIGHEST SCORING FOLD IS BELOW THIS THRESHOLD YOUR PREDICTION IS NOT RELIABLE. You may conclude that: IF the fold of your sequence is similar to one already observed, THEN: - Our method is not sensitive enough to assign a fold for your sequence, and/or - It may be contained within a larger fold, and/or - The fold of your sequence is not included in our library of folds. IF your sequence corresponds to a new, unobserved fold, THEN: - Our method reflects this by a below threshold score. Additional information for your prediction can be found at the url: http://www.mbi.ucla.edu/people/frsvr/preds/24862t0074 Below is the alignment of your sequence with the top hit structure. In the near future, all the alignments in a more readable format will be made available. hhhhhhhhhh bbb h hhhhh PEDKAKYDAIFDSLSPVNGFLS..GDKVKPVLLNSKLPV......DILGR || | || | | MKSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGPSTLDE hhhhhhhhhhhh hhhhhhhhhhh hhhh hhh hhhhhh hhhhhhhhhhh VWELSDIDHDGMLDRDEFAVAMFLV | | || || | LFEELDKNGDGEVSFEEFQVLVKKI hhhhh hhhhhhhhhhh 20%