SERVERNAME: frsvr_SDPMA TARGET: T0070 PARAMETERS: excludefolds: 1kja 1hli include h3p2 URL: http://www.cs.bgu.ac.il/~dfischer/cafasp1/frsvr_SDPMA.t0070 SERVER'S URL: http://www.doe-mbi.ucla.edu/people/frsvr/submit.html RANK FOLD SCORE LENGTH_ALIGNMENT SEQ_ID% 1 2por 16.13 288 18 2 2omf 12.12 297 21 3 1prn 10.26 276 22 4 1fyc 4.21 102 15 5 1nbca 3.81 150 17 6 1wkt 3.77 88 11 7 1pse 3.45 69 13 8 1dro 3.20 122 16 9 1ahl 3.15 41 24 10 1gof_1-150 3.01 138 17 END The following are additional results for your prediction obtained using a multiple alignment of sequences homologous to your submitted sequence. The sequences in the multiple alignment (in addition to your sequence) are: om32_comac omb1_neime omb2_neime omb3_neime omb4_neime omp_borpe This method (MULT+gonnet+predss) is still under testing. Comparing the results of the predictions for the homologous sequences may provide further information. You can obtain these by submitting them to this server. The three-dimensional fold predicted for your amino acid sequence is in the table below. HERE I INCLUDE ONLY THE RESULTS OF THE MULT+gonnet+predss METHOD. THE OTHER RESULTS CAN BE FOUND AT THE URL (www page) SPECIFIED AT THE END OF THIS MESSAGE. Please cite: Fischer, D. and Eisenberg, D. Fold Recognition Using Sequence-Derived Predictions. Protein Science, 5, 947-955, 1996. Your sequence was translated to: seq.seq Length: 332 December 25, 1998 04:18 Type: P Check: 4899 .. 1 QSSVTLFGIV DTNVAYVNKD AAGDSRYGLG TSGASTSRLG LRGTEDLGGG 51 LKAGFWLEGE IFGDDGNASG FNFKRRSTVS LSGNFGEVRL GRDLVPTSQK 101 LTSYDLFSAT GIGPFMGFRN WAAGQGADDN GIRANNLISY YTPNFGGFNA 151 GFGYAFDEKQ TIGTADSVGR YIGGYVAYDN GPLSASLGLA QQKTAVGGLA 201 TDRDEITLGA SYNFGVAKLS GLLQQTKFKR DIGGDIKTNS YMLGASAPVG 251 GVGEVKLQYA LYDQKAIDSK AHQITLGYVH NLSKRTALYG NLAFLKNKDA 301 STLGLQAKGV YAGGVQAGES QTGVQVGIRH AF NAME: t0070 FROM: dfischer@indigo.cs.bgu.ac.il BY YOUR REQUEST I HAVE NOT USED THE FOLLOWING FOLDS: 1hli 1kja The method used for this prediction was: MULT+gonnet+predss . Most similar fold: 2por PORIN (CRYSTAL FORM B) RANK Z-SCORE FOLD LENGTHALI %ID 1 16.13 2por 288 18 6-6 MEMBR ; Porins] 6-6-1-1-1-2- 2 12.12 2omf 297 21 6-6 MEMBR ; Porins] 6-6-1-1-1-1- 3 10.26 1prn 276 22 6-6 MEMBR ; Porins] 6-6-1-1-1-3- 4 4.21 1fyc 102 15 1997 new ; INNER LIPOYL DOMAIN FROM HUMAN PYRUVATE DEHYDROGEN 5 3.81 1nbca 150 17 1997 new ; BACTERIAL TYPE 3A CELLULOSE-BINDING DOMAIN 6 3.77 1wkt 88 11 1997 new ; WILLIOPSIS MRAKII KILLER TOXIN, NMR SOLUTION STRUCTU 7 3.45 1pse 69 13 2-19 beta ; SH3-like barrel] 2-19-5-1-1-1- 8 3.20 1dro 122 16 2-32 beta ; PH domain-like] 2-32-1-1-1-2- 9 3.15 1ahl 41 24 7-7 small ; Defensin-like] 7-7-1-1-6-1- 10 3.01 1gof_1-150 138 17 2-12 beta ; Galactose-binding domain-like] 2-12-1-1-1-1-1- 11 3.01 2sga 150 19 2-26 beta ; Trypsin-like serine proteases] 2-26-1-1-2-1- 12 2.81 1ttg 90 17 2-1 beta ; Immunoglobulin-like beta-sandwich] 2-1-2-1-2-1- 13 2.72 1cgt_580-684 103 14 2-3 beta ; Prealbumin-like] 2-3-1-1-1-1-2- 14 2.69 1bpk 117 10 10-1 NON ; Theoretical Models] 10-1-1-2-3-1- 15 2.67 1kvdb 72 18 1997 new ; KILLER TOXIN FROM HALOTOLERANT YEA LEGEND: COL. 1: RANK. The ranks are obtained by sorting the fold library, by Z-SCORES, in decreasing order. Only the 15 structures that are most compatible to your sequence are shown. COL. 2: Z-SCORE. The z-scores are computed using the distribution of raw scores (not shown) of all folds. COL. 3: FOLD. Protein Data Bank codes for the coordinates of the 3D structures. COL. 4: LENGTHALI. The number of residues from your sequence that were aligned to the fold. COL. 5: % ID. Percentage of identical residues in the alignment. RELIABILITY OF THIS PREDICTION: With this method the confidence threshold is a z-score of 5.0 +- 1.0. YOUR HIGHEST SCORING FOLD IS ABOVE THIS THRESHOLD Additional information for your prediction can be found at the url: http://www.mbi.ucla.edu/people/frsvr/preds/24455t0070 Below is the alignment of your sequence with the top hit structure. In the near future, all the alignments in a more readable format will be made available. bbbbbbbb b bbb SVTLFGIVDTNVAYVNKDAAGDSRYGLGTSGASTSRLGLRGTEDLGGGLK | | | | | | || || | | EVKLSGDARMGVMYNGDDWNFSSRSRVL........FTMSGTTDSGLEFG bbbbbbbbbbbbb bbbbbbbbbb bbbbbb bbb bbbbbbb b bbbbbb bbbb AGFWLEGEIFGDDGNASGFNFKRRSTVSLSGNFGEVRLGRDLVPTSQKLT | | | || ||| || | | ASFKAHESVGAETGEDG........TVFLSGAFGKIEMGDALGASEALFG bbbbhhhhhhh bbbbbb bbbbbb hhhhhh bb bbbbbbb bbb SYDLFSATGIGPFMGFRNWAAGQGADDNGIRANNLISYYTPNFGGFNAGF | | | | | DLYEVGYTDLDDRGG.NDIPYLTGDERLTAEDNPVLLY...TYSAGAFSV bbbb bbbb bbb bbb b bbbbbb bbbbb h GYAFDEKQTIGTADSVGRYIGGYVAYDNGPLSASLGLAQQKTAVGGLATD | || | || | | AASMSDGKVGETSEDDAQEMAVAAAYTFGNYTVGLGYEKIDSPDTALMAD bbbb bbbbbbbbbbb bbbbbbbbbbb hhhhhhhhhhhhh RDEITLGASYNFGVAKLSGLLQQTKFKRD.............IGGDIKTN | | || || MEQLELAAIAKFGATNVKAYYADGELDRDFARAVFDLTPVAAAATAVDHK bbbbbbbbbbbb bbbbbbbbbbbbbhhhhhhh bbbbb bbb bb bbbbbbbb bbbbb bb bbbbb SYMLGASAPVGGVGEVKLQYALYDQKAIDSKAHQITLGYVHNLSKRTALY | | | | || | AYGLSVDSTFGA..TTVGGYVQVLDIDTIDDVTYYGLGASYDLGGGASIV bbbbbbbbbb bbbbbbbbbbbb bbbbbbbbbbbbbbb bbbb hhhhhhh bbbbbbbbb GNLAFLKNKDASTLGLQAKGVYAG | | || G..GIADNDLPNSDMVADLGVKFK b bbbbb bbbbbbbbb 18%