SERVERNAME: frsvr_SDPMA TARGET: T0044 PARAMETERS: excludefolds: 1kja 1hli include h3p2 URL: http://www.cs.bgu.ac.il/~dfischer/cafasp1/frsvr_SDPMA.t0044 SERVER'S URL: http://www.doe-mbi.ucla.edu/people/frsvr/submit.html RANK FOLD SCORE LENGTH_ALIGNMENT SEQ_ID% 1 1chd 7.77 182 18 2 1ayaa 4.56 100 17 3 8adh_1-373 3.70 168 23 4 1eps1 3.47 279 16 5 1pkn_396-530 3.45 130 15 6 1rypb 3.28 222 16 7 1rypd 3.21 213 16 8 2cmd 3.18 258 19 9 1pdnc 3.17 123 15 10 1dlha_3-81 3.04 77 13 11 1poh 2.96 85 20 12 1ttg 2.86 90 20 13 1bak 2.61 114 12 14 1eqia 2.54 104 17 15 1kuh 2.54 107 25 END The following are additional results for your prediction obtained using a multiple alignment of sequences homologous to your submitted sequence. The sequences in the multiple alignment (in addition to your sequence) are: rtc1_human rtca_ecoli rtca_metja This method (MULT+gonnet+predss) is still under testing. Comparing the results of the predictions for the homologous sequences may provide further information. You can obtain these by submitting them to this server. The three-dimensional fold predicted for your amino acid sequence is in the table below. HERE I INCLUDE ONLY THE RESULTS OF THE MULT+gonnet+predss METHOD. THE OTHER RESULTS CAN BE FOUND AT THE URL (www page) SPECIFIED AT THE END OF THIS MESSAGE. Please cite: Fischer, D. and Eisenberg, D. Fold Recognition Using Sequence-Derived Predictions. Protein Science, 5, 947-955, 1996. Your sequence was translated to: seq.seq Length: 347 December 31, 1998 16:56 Type: P Check: 6794 .. 1 MVKRMIALDG AQGEGGGQIL RSALSLSMIT GQPFTITSIR AGRAKPGLLR 51 QHLTAVKAAT EICGATVEGA ELGSQRLLFR PGTVRGGDYR FAIGSAGSCT 101 LVLQTVLPAL WFADGPSRVE VSGGTDNPSA PPADFIRRVL EPLLAKIGIH 151 QQTTLLRHGF YPAGGGVVAT EVSPVASFNT LQLGERGNIV QMRGEVLLAG 201 VPRHVAEREI ATLAGSFSLH EQNIHNLPRD QGPGNTVSLE VESENITERF 251 FVVGEKRVSA EVVAAQLVKE VKRYLASTAA VGEYLADQLV LPMALAGAGE 301 FTVAHPSCHL LTNIAVVERF LPVRFSLIET DGVTRVSIEG SHHHHHH NAME: t044 FROM: dfischer@indigo.cs.bgu.ac.il BY YOUR REQUEST I HAVE NOT USED THE FOLLOWING FOLDS: 1an3b 1az7 1bd9a 1bg8a 1bl0a 1cdaa 1hli 1illg 1kja The method used for this prediction was: MULT+gonnet+predss . Most similar fold: 1chd MOL_ID: 1; 2 MOLECULE: CHEB METHYLESTERASE; 3 CHAIN: NULL; 4 DOMAIN: METHYLESTERASE DOMAIN (C-TERMINAL RESIDU 5 349); 6 EC: 3.1.1.61; 7 ENGINEERED: YES RANK Z-SCORE FOLD LENGTHALI %ID 1 7.77 1chd 182 18 3-22 a/b ; CheB methylesterase domain (C-terminal residues 152-349)] 3-22-1-1-1-1- 2 4.56 1ayaa 100 17 4-41 (a+b) ; SH2-like] 4-41-1-1-4-1-1- 3 3.70 8adh_1-373 168 23 2-20 beta ; GroES-like] 2-20-1-2-1-1-8-1 R 4 3.47 1eps1 279 16 199 5 3.45 1pkn_396-530 130 15 3-29 a/b ; Pyruvate kinase, C-terminal domain] 3-29-1-1-1-2-1- 6 3.28 1rypb 222 16 1998 7 3.21 1rypd 213 16 1998 8 3.18 2cmd 258 19 99--3-15--4-74 [ a/b ; NAD(P)-binding Rossmann-fold domains] [(a+b) ; Lactate & malate dehydrogenases, C-terminal domain] [MULTIDOMAIN ; ] 99--3-15--4-74 [(a/b) ; NAD(P)-binding Rossmann-fold domains] [ (a+b) ; Lactate & malate dehydrogenases, C-terminal domain] 9 3.17 1pdnc 123 15 1-4 alpha ; DNA-binding 3-helical bundle] 1-4-1-4-1-1-1- 10 3.04 1dlha_3-81 77 13 4-12 (a+b) ; MHC antigen-recognition domain] 4-12-1-1-2-1-1-1 RC: 11 2.96 1poh 85 20 4-42 (a+b) ; Histidine-containing phosphocarrier proteins (HPr)] 4-42-1-1-1-3- 12 2.86 1ttg 90 20 2-1 beta ; Immunoglobulin-like beta-sandwich] 2-1-2-1-2-1- 13 2.61 1bak 114 12 1998 14 2.54 1eqia 104 17 10-1 NON ; Theoretical Models] 10-1-1-10-14-1- 15 2.54 1kuh 107 25 1997 new ; ZINC PROTEASE FROM STREPTOMYCES CAESPITOS LEGEND: COL. 1: RANK. The ranks are obtained by sorting the fold library, by Z-SCORES, in decreasing order. Only the 15 structures that are most compatible to your sequence are shown. COL. 2: Z-SCORE. The z-scores are computed using the distribution of raw scores (not shown) of all folds. COL. 3: FOLD. Protein Data Bank codes for the coordinates of the 3D structures. COL. 4: LENGTHALI. The number of residues from your sequence that were aligned to the fold. COL. 5: % ID. Percentage of identical residues in the alignment. RELIABILITY OF THIS PREDICTION: With this method the confidence threshold is a z-score of 5.0 +- 1.0. YOUR HIGHEST SCORING FOLD IS ABOVE THIS THRESHOLD Additional information for your prediction can be found at the url: http://www.mbi.ucla.edu/people/frsvr/preds/24519t044 Below is the alignment of your sequence with the top hit structure. In the near future, all the alignments in a more readable format will be made available. bbbbbb bbbb bb bbbbbb h MVKRMIALDGAQGEGGGQILRSALSLSMITGQPFTITSIRAGRAKPGLLR || || | | || || | SSEKLIAIGAS..TGGTEAIRHVLQPLPLSSPAVIITQ....HMPPGFTR bbbbbbb hhhhhhhhhhh bbbbbb b hhhh hhhhhhhhhhhhh bbbb bbbbbb bbbb QHLTAVKAATEICGATVEGAELGSQRLLFRPGT..VRGGDYRFAIGSAGS | | || | | || || | SF...AERLNKLCQISVKEAEDGERVL...PGHAYIAPGDKHMELARSGA hh hhhhhhhh bbbbb bbbbbb bbbbbbb bbbbbbb bb bbbbb hhhhhhhhhhhhh CTLVLQTVLPALWFADGPSRVEVSGGTDNPSAPPADFIRRVLEPLLAKIG | | | .................NYQIKIHDGPPVNRHRPS..VDVLFHSVAKHAG bbbbbbb h hhhhhhhhhhhh bbbbbb bbbbbb IHQQTTLLRH..........GFYPAGGGVVATEVSPVASF....NTLQLG | | || | | | RNAVGVILTGMGNDGAAGMLAMYQAGAWTIAQNEASCVVFGMPREAINMG bbbbbbb hhhhhhhhhhh bbbbbb hhhhhhhhh bbbbbbbbbbb hhhhhhhhhhhh ERGNIVQMRGEVLLAGVPRHVAEREIATLAGS | | | GVSEVVDL..........SQVSQQMLAKISAG bbbhh hhhhhhhhhhhh 20%