SERVERNAME: frsvr_SDP TARGET: T0083 PARAMETERS: excludefolds: 1an3b 1az7 1bd9a 1bg8a 1bl0a 1cdaa 1hli 1illg 1kja include h3p2 URL: http://www.cs.bgu.ac.il/~dfischer/cafasp1/frsvr_SDP.t0083 SERVER'S URL: http://www.doe-mbi.ucla.edu/people/frsvr/submit.html RANK FOLD SCORE LENGTH_ALIGNMENT SEQ_ID% 1 1babb 4.68 114 21 2 1pbxb 3.86 120 13 3 1lmb3 3.45 83 29 4 2end 2.97 101 22 5 2tct 2.90 151 19 6 3sdha 2.62 120 20 7 1buca_233-383 2.55 129 21 8 1br1b 2.53 119 21 9 1avob 2.50 127 14 10 1ldna_15-162 2.44 125 15 11 1hbg 2.43 112 22 12 1cpq 2.40 102 26 13 1beo 2.35 97 21 14 1bcfa 2.34 131 21 15 1a7va 2.33 108 21 END The three-dimensional fold predicted for your amino acid sequence is in the table below. HERE I INCLUDE ONLY THE RESULTS OF THE gonnet+predss METHOD. THE OTHER RESULTS CAN BE FOUND AT THE URL (www page) SPECIFIED AT THE END OF THIS MESSAGE. Please cite: Fischer, D. and Eisenberg, D. Fold Recognition Using Sequence-Derived Predictions. Protein Science, 5, 947-955, 1996. * * * * N O T E * * * * PLEASE CONSULT ALSO THE RESULTS OF gonnet+predss+multi Your sequence was translated to: seq.seq Length: 156 January 5, 1999 22:42 Type: P Check: 5589 .. 1 MIQSQINRNI RLDLADAILL SKAKKDLSFA EIADGTGLAE AFVTAALLGQ 51 QALPADAARL VGAKLDLDED SILLLQMIPL RGCIDDRIPT DPTMYRFYEM 101 LQVYGTTLKA LVHEKFGDGI ISAINFKLDV KKVADPEGGE RAVITLDGKY 151 LPTKPF NAME: t0083full FROM: dfischer@indigo.cs.bgu.ac.il BY YOUR REQUEST I HAVE NOT USED THE FOLLOWING FOLDS: 1an3b 1az7 1bd9a 1bg8a 1bl0a 1cdaa 1hli 1illg 1kja 2hie The method used for this prediction was: gonnet+predss . Most similar fold: 1babb HEMOGLOBIN THIONVILLE ALPHA CHAIN MUTANT WITH VAL 2 REPLACED BY GLU AND AN ACETYLATED MET BOUND TO T 3 AMINO TERMINUS RANK Z-SCORE FOLD LENGTHALI %ID 1 4.68 1babb 114 21 1-1 alpha ; Globin-like] 1-1-1-1-7-1-26- 2 3.86 1pbxb 120 13 1-1 alpha ; Globin-like] 1-1-1-1-7-7-1- 3 3.45 1lmb3 83 29 1-25 alpha ; lambda repressor-like DNA-binding domains] 1-25-1-2-1-1-1- 4 2.97 2end 101 22 1-14 alpha ; T4 endonuclease V] 1-14-1-1-1-1- 5 2.90 2tct 151 19 1-62 alpha ; Tetracyclin repressor (Tet-repressor, TetR)] 1-62-1-1-1-1- 6 2.62 3sdha 120 20 1-1 alpha ; Globin-like] 1-1-1-1-1-1-1- 7 2.55 1buca_233-383 129 21 1-20 alpha ; Four-helical up-and-down bundle] 1-20-6-1-1-1-1- 8 2.53 1br1b 119 21 199 9 2.50 1avob 127 14 1998 10 2.44 1ldna_15-162 125 15 3-15 a/b ; NAD(P)-binding Rossmann-fold domains] 3-15-1-5-3-4-1- 11 2.43 1hbg 112 22 1-1 alpha ; Globin-like] 1-1-1-1-2-1- 12 2.40 1cpq 102 26 1997 new ; CYTOCHROME C' FROM RHODOPSEUDOMONAS CAPSULA 13 2.35 1beo 97 21 1997 new ; BETA-CRYPTOGEIN 14 2.34 1bcfa 131 21 1-21 alpha ; Ferritin like] 1-21-1-1-1-1-1- 15 2.33 1a7va 108 21 199 LEGEND: COL. 1: RANK. The ranks are obtained by sorting the fold library, by Z-SCORES, in decreasing order. Only the 15 structures that are most compatible to your sequence are shown. COL. 2: Z-SCORE. The z-scores are computed using the distribution of raw scores (not shown) of all folds. COL. 3: FOLD. Protein Data Bank codes for the coordinates of the 3D structures. COL. 4: LENGTHALI. The number of residues from your sequence that were aligned to the fold. COL. 5: % ID. Percentage of identical residues in the alignment. RELIABILITY OF THIS PREDICTION: With this method the confidence threshold is a z-score of 4.8 +- 1.0. YOUR HIGHEST SCORING FOLD IS BELOW THIS THRESHOLD YOUR PREDICTION IS NOT RELIABLE. You may conclude that: IF the fold of your sequence is similar to one already observed, THEN: - Our method is not sensitive enough to assign a fold for your sequence, and/or - It may be contained within a larger fold, and/or - The fold of your sequence is not included in our library of folds. IF your sequence corresponds to a new, unobserved fold, THEN: - Our method reflects this by a below threshold score. Below is the alignment of your sequence with the top hit structure. In the near future, all the alignments in a more readable format will be made available. hhhhhhhhhhhhhhh hhhhhhhh hhhhhh IRLDLADAILLSKAKKDLSFAEIADGTGLAEAFV................ | | | | | VHLTPEEKSAVTALWGKVNVDEVG.GEALGRLLVVYPWTQRFFESFGDLS hhhhhhhhhhh hhhhh hhhhhhhhhh hhhhhh hhh hhhhhhhhh hhhhhhhhhhhh hhhhhhh .TAALLGQQALPADAARLVGAKLDLDEDSILLLQMIPLRGCID.DRIPTD | | | || | | | | TPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVD hhhhhh hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh hhhhhhhhhhhhhhh hhhhhhhhh bbbhh PTMYRFYEMLQVYGTTLKALVHEKFGDGIISAIN | | | | || PENFRLL......GNVLVCVLAHHFGKEFTPPVQ hhhhhh hhhhhhhhhhhhhhh hhhh 18% Additional information for your prediction can be found at the url: http://www.doe-mbi.ucla.edu/people/frsvr/preds/24572t0083full/24572t0083full.html p.s. if you need further information on this output, send an e-mail message to: fischer@mbi.ucla.edu