SERVERNAME: frsvr_SDP TARGET: T0074 PARAMETERS: excludefolds: 1an3b 1az7 1bd9a 1bg8a 1bl0a 1cdaa 1hli 1illg 1ilma 1kja 2hie include h3p2 URL: http://www.cs.bgu.ac.il/~dfischer/cafasp1/frsvr_SDP.t0074 SERVER'S URL: http://www.doe-mbi.ucla.edu/people/frsvr/submit.html RANK FOLD SCORE LENGTH_ALIGNMENT SEQ_ID% 1 1trca 5.16 65 25 2 4icb 4.72 68 25 3 3ctn 4.51 69 25 4 5pal 4.06 72 28 5 1trf 4.05 72 28 6 1adr 3.68 62 23 7 1jvr 3.66 97 25 8 1syma 3.43 74 34 9 1thba 3.05 94 21 10 1fcba_1-97 2.98 75 29 11 1sra 2.90 81 26 12 4cpv 2.84 71 28 13 1gg2g 2.74 51 24 14 1rro 2.58 71 25 15 1avoa 2.47 43 37 END The three-dimensional fold predicted for your amino acid sequence is in the table below. HERE I INCLUDE ONLY THE RESULTS OF THE gonnet+predss METHOD. THE OTHER RESULTS CAN BE FOUND AT THE URL (www page) SPECIFIED AT THE END OF THIS MESSAGE. Please cite: Fischer, D. and Eisenberg, D. Fold Recognition Using Sequence-Derived Predictions. Protein Science, 5, 947-955, 1996. * * * * N O T E * * * * PLEASE CONSULT ALSO THE RESULTS OF gonnet+predss+multi Your sequence was translated to: seq.seq Length: 98 January 19, 1999 09:25 Type: P Check: 2844 .. 1 PWAVKPEDKA KYDAIFDSLS PVNGFLSGDK VKPVLLNSKL PVDILGRVWE 51 LSDIDHDGML DRDEFAVAMF LVYCALEKEP VPMSLPPALV PPSKRKTW NAME: t0074 FROM: dfischer@indigo.cs.bgu.ac.il BY YOUR REQUEST I HAVE NOT USED THE FOLLOWING FOLDS: 1an3b 1az7 1bd9a 1bg8a 1bl0a 1cdaa 1hli 1illg 1kja 2hie The method used for this prediction was: gonnet+predss . Most similar fold: 1trca CALMODULIN (/TR=2=C$ FRAGMENT COMPRISING RESIDUES 2 OF THE INTACT MOLECULE) RANK Z-SCORE FOLD LENGTHALI %ID 1 5.16 1trca 65 25 1-28 alpha ; EF-hand] 1-28-1-5-4-2-4- 2 4.72 4icb 68 25 1-28 alpha ; EF-hand] 1-28-1-1-1-1- 3 4.51 3ctn 69 25 1998 4 4.06 5pal 72 28 1-28 alpha ; EF-hand] 1-28-1-4-2-3- 5 4.05 1trf 72 28 1-28 alpha ; EF-hand] 1-28-1-5-1-2- 6 3.68 1adr 62 23 1-25 alpha ; lambda repressor-like DNA-binding domains] 1-25-1-2-4-1- 7 3.66 1jvr 97 25 1997 new ; STRUCTURE OF THE HTLV-II MATRIX PROTEIN, NMR, 20 STRUCTUR 8 3.43 1syma 74 34 1997 new ; 3-D SOLUTION STRUCTURE OF REDUCED APO-S100B FROM RAT, NM 9 3.05 1thba 94 21 1-1 alpha ; Globin-like] 1-1-1-1-6-1-4- 10 2.98 1fcba_1-97 75 29 4-53 (a+b) ; Cytochrome b5] 4-53-1-1-2-1-3- 11 2.90 1sra 81 26 1-28 alpha ; EF-hand] 1-28-1-3-1-1- 12 2.84 4cpv 71 28 1-28 alpha ; EF-hand] 1-28-1-4-2-1- 13 2.74 1gg2g 51 24 1997 new ; G PROTEIN HETEROTRIMER MUTANT GI_ALPHA_1(G203A) BETA 14 2.58 1rro 71 25 1-28 alpha ; EF-hand] 1-28-1-4-1-1- 15 2.47 1avoa 43 37 1998 LEGEND: COL. 1: RANK. The ranks are obtained by sorting the fold library, by Z-SCORES, in decreasing order. Only the 15 structures that are most compatible to your sequence are shown. COL. 2: Z-SCORE. The z-scores are computed using the distribution of raw scores (not shown) of all folds. COL. 3: FOLD. Protein Data Bank codes for the coordinates of the 3D structures. COL. 4: LENGTHALI. The number of residues from your sequence that were aligned to the fold. COL. 5: % ID. Percentage of identical residues in the alignment. RELIABILITY OF THIS PREDICTION: With this method the confidence threshold is a z-score of 4.8 +- 1.0. YOUR HIGHEST SCORING FOLD IS ABOVE THIS THRESHOLD BUT ONLY SLIGHTLY HIGHER. THE PREDICTION IS NOT VERY RELIABLE. You may conclude that: IF the fold of your sequence is similar to one already observed, THEN: - Our method is not sensitive enough to assign a fold for your sequence, and/or - It may be contained within a larger fold, and/or - The fold of your sequence is not included in our library of folds. IF your sequence corresponds to a new, unobserved fold, THEN: - Our method reflects this by a below threshold score. Below is the alignment of your sequence with the top hit structure. In the near future, all the alignments in a more readable format will be made available. bbb hhhhhhhhhhhh hhhhhhhh VNGFLSGDKVKPVLLN..SKLPVDILGRVWELSDIDHDGMLDRDEFAVAM || | | | || ||| || || | GNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMM hhhhhhhhhh hhh 31% Additional information for your prediction can be found at the url: http://www.doe-mbi.ucla.edu/people/frsvr/preds/24862t0074/24862t0074.html p.s. if you need further information on this output, send an e-mail message to: fischer@mbi.ucla.edu