SERVERNAME: frsvr_SDP TARGET: T0063 PARAMETERS: excludefolds: 1an3b 1az7 1bd9a 1bg8a 1bl0a 1cdaa 1hli 1illg 1kja include h3p2 URL: http://www.cs.bgu.ac.il/~dfischer/cafasp1/frsvr_SDP.t0063 SERVER'S URL: http://www.doe-mbi.ucla.edu/people/frsvr/submit.htmlO RANK FOLD SCORE LENGTH_ALIGNMENT SEQ_ID% 1 2rspa 4.46 107 19 2 1rsy 3.53 123 15 3 1lcl 3.36 116 23 4 1pkn_116-217 3.08 68 29 5 1ncg 2.96 86 21 6 3gapa_1-137 2.92 102 26 7 1cgt_580-684 2.80 98 12 8 1rie 2.61 82 27 9 2fxb 2.56 78 26 10 1umua 2.46 76 25 11 1rip 2.46 63 27 12 1who 2.44 91 27 13 1bbrh 2.41 108 24 14 1sro 2.39 71 34 15 6gch 2.31 113 26 END The three-dimensional fold predicted for your amino acid sequence is in the table below. HERE I INCLUDE ONLY THE RESULTS OF THE gonnet+predss METHOD. THE OTHER RESULTS CAN BE FOUND AT THE URL (www page) SPECIFIED AT THE END OF THIS MESSAGE. Please cite: Fischer, D. and Eisenberg, D. Fold Recognition Using Sequence-Derived Predictions. Protein Science, 5, 947-955, 1996. * * * * N O T E * * * * PLEASE CONSULT ALSO THE RESULTS OF gonnet+predss+multi Your sequence was translated to: seq.seq Length: 138 January 4, 1999 15:33 Type: P Check: 4692 .. 1 MVLKWVMSTK YVEAGELKEG SYVVIDGEPC RVVEIEKSKT GKHGSAKARI 51 VAVGVFDGGK RTLSLPVDAQ VEVPIIEKFT AQILSVSGDV IQLMDMRDYK 101 TIEVPMKYVE EEAKGRLAPG AEVEVWQILD RYKIIRVK NAME: t0063full FROM: dfischer@indigo.cs.bgu.ac.il BY YOUR REQUEST I HAVE NOT USED THE FOLLOWING FOLDS: 1an3b 1az7 1bd9a 1bg8a 1bl0a 1cdaa 1hli 1illg 1kja The method used for this prediction was: gonnet+predss . Most similar fold: 2rspa ROUS SARCOMA VIRUS PROTEASE (/RSV PR$) RANK Z-SCORE FOLD LENGTHALI %ID 1 4.46 2rspa 107 19 2-29 beta ; Acid proteases] 2-29-1-1-4-1-1- 2 3.53 1rsy 123 15 2-1 beta ; Immunoglobulin-like beta-sandwich] 2-1-9-1-1-1- 3 3.36 1lcl 116 23 1997 new ; CHARCOT-LEYDEN CRYSTAL PROTE 4 3.08 1pkn_116-217 68 29 2-33 beta ; Pyruvate kinase beta-barrel domain] 2-33-1-1-1-1-1- 5 2.96 1ncg 86 21 2-1 beta ; Immunoglobulin-like beta-sandwich] 2-1-5-1-1-1- 6 2.92 3gapa_1-137 102 26 2-49 beta ; Double-stranded beta-helix] 2-49-2-1-1-1-2- 7 2.80 1cgt_580-684 98 12 2-3 beta ; Prealbumin-like] 2-3-1-1-1-1-2- 8 2.61 1rie 82 27 1997 new ; 2 STRUCTURE OF A WATER SOLUBLE FRAGMENT OF THE RIES 9 2.56 2fxb 78 26 4-26 (a+b) ; Ferredoxin-like] 4-26-1-3-2-1- 10 2.46 1umua 76 25 1997 new ; STRUCTURE DETERMINATION OF UMUD' BY MAD PHASING OF T 11 2.46 1rip 63 27 2-21 beta ; OB-fold] 2-21-7-1-1-1- 12 2.44 1who 91 27 1997 new ; ALLERGEN PHL P 2 13 2.41 1bbrh 108 24 2-26 beta ; Trypsin-like serine proteases] 2-26-1-2-4-2-5- 14 2.39 1sro 71 34 2-21 new ; S1 RNA BINDING DOMAIN, NMR, 20 STRUCTUR 15 2.31 6gch 113 26 2-26 beta ; Trypsin-like serine proteases] 2-26-1-2-2-1-1 LEGEND: COL. 1: RANK. The ranks are obtained by sorting the fold library, by Z-SCORES, in decreasing order. Only the 15 structures that are most compatible to your sequence are shown. COL. 2: Z-SCORE. The z-scores are computed using the distribution of raw scores (not shown) of all folds. COL. 3: FOLD. Protein Data Bank codes for the coordinates of the 3D structures. COL. 4: LENGTHALI. The number of residues from your sequence that were aligned to the fold. COL. 5: % ID. Percentage of identical residues in the alignment. RELIABILITY OF THIS PREDICTION: With this method the confidence threshold is a z-score of 4.8 +- 1.0. YOUR HIGHEST SCORING FOLD IS BELOW THIS THRESHOLD YOUR PREDICTION IS NOT RELIABLE. You may conclude that: IF the fold of your sequence is similar to one already observed, THEN: - Our method is not sensitive enough to assign a fold for your sequence, and/or - It may be contained within a larger fold, and/or - The fold of your sequence is not included in our library of folds. IF your sequence corresponds to a new, unobserved fold, THEN: - Our method reflects this by a below threshold score. Below is the alignment of your sequence with the top hit structure. In the near future, all the alignments in a more readable format will be made available. bb bbbbbbbb bbbbbbbbbbb VIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDGGKR.TLSLPVDAQVE | || | | | | | TMEHKDRPLVRVILTNTGSHPVKQRSVYITALLDSGADITIISEEDWPTD bbbbbbbb bbbbbbbb bbb bbbbb bbbbb VPIIEKFTAQILSVSGDVIQLMDMRDYKTIEVPM | | | | | | | | WPVMEAAGIP.MRKSRDMIELGVINRDGSLERPL bbb bbbb bbbbbb b 19% Additional information for your prediction can be found at the url: http://www.doe-mbi.ucla.edu/people/frsvr/preds/24557t0063full/24557t0063full.html p.s. if you need further information on this output, send an e-mail message to: fischer@mbi.ucla.edu