SERVERNAME: frsvr_SDP TARGET: T0055 PARAMETERS: excludefolds: 1kja 1hli include h3p2 URL: http://www.cs.bgu.ac.il/~dfischer/cafasp1/frsvr_SDP.t0055 SERVER'S URL: http://www.doe-mbi.ucla.edu/people/frsvr/submit.html RANK FOLD SCORE LENGTH_ALIGNMENT SEQ_ID% 1 1esl 11.52 113 31 2 1lit 9.23 119 20 3 2msbb 9.13 110 19 4 1msba 8.79 113 18 5 1ixxb 7.23 109 27 6 1rtm2 6.97 112 19 7 1ixxa 5.81 106 25 8 1bec 3.42 79 27 9 1htn 3.23 114 19 10 1ae7 3.12 91 22 END NOTICE: the excludefolds excludes 2 library entries which are models. The three-dimensional fold predicted for your amino acid sequence is in the table below. HERE I INCLUDE ONLY THE RESULTS OF THE gonnet+predss METHOD. THE OTHER RESULTS CAN BE FOUND AT THE URL (www page) SPECIFIED AT THE END OF THIS MESSAGE. Please cite: Fischer, D. and Eisenberg, D. Fold Recognition Using Sequence-Derived Predictions. Protein Science, 5, 947-955, 1996. * * * * N O T E * * * * PLEASE CONSULT ALSO THE RESULTS OF gonnet+predss+multi Your sequence was translated to: seq.seq Length: 125 December 21, 1998 08:33 Type: P Check: 7777 .. 1 MDYEILFSDE TMNYADAGTY CQSRGMALVS SAMRDSTMVK AILAFTEVKG 51 HDYWVGADNL QDGAYNFLWN DGVSLPTDSD LWSPNEPSNP QSWQLCVQIW 101 SKYNLLDDVG CGGARRVICE KELDD NAME: t0055 FROM: dfischer@indigo.cs.bgu.ac.il BY YOUR REQUEST I HAVE NOT USED THE FOLLOWING FOLDS: 1hli 1kja The method used for this prediction was: gonnet+predss . Most similar fold: 1esl E-SELECTIN (LECTIN AND EGF DOMAINS, RESIDUES 1 - 2 (FORMERLY KNOWN AS ELAM-1) RANK Z-SCORE FOLD LENGTHALI %ID 1 11.52 1esl 113 31 99--4-77--7-10 [(a+b) ; C-type lectin] [small ; EGF-like module] [MULTIDOMAIN ; ] 99--4-77--7-10 [(a+b) ; C-type lectin] [small ; EGF-like module] 2 9.23 1lit 119 20 1997 new ; HUMAN LITHOSTATHI 3 9.13 2msbb 110 19 4-77 (a+b) ; C-type lectin] 4-77-1-1-2-2-1- 4 8.79 1msba 113 18 4-77 (a+b) ; C-type lectin] 4-77-1-1-2-2-13- 5 7.23 1ixxb 109 27 1998 6 6.97 1rtm2 112 19 99--4-77 [(a+b) ; C-type lectin] [MULTIDOMAIN ; ] 99--4-77 [(a+b) ; C-type lectin] 7 5.81 1ixxa 106 25 1998 8 3.42 1bec_118-246 79 27 2-1 beta ; Immunoglobulin-like beta-sandwich] 2-1-1-2-1-1-1- 9 3.23 1htn 114 19 1998 10 3.12 1ae7 91 22 1997 new ; NOTEXIN, A PRESYNAPTIC NEUROTOXIC PHOSPHOLIPASE A 11 3.01 3ebx 53 32 7-5 small ; Snake toxin-like] 7-5-1-1-1-1- 12 2.99 1wkt 67 22 1997 new ; WILLIOPSIS MRAKII KILLER TOXIN, NMR SOLUTION STRUCTU 13 2.62 1msaa 99 19 2-45 beta ; beta-Prism II] 2-45-1-1-1-1-1- 14 2.59 3hhrb_32-130 73 19 2-1 beta ; Immunoglobulin-like beta-sandwich] 2-1-2-1-5-1-1- 15 2.43 1tpka 65 17 7-12 small ; Kringle modules] 7-12-1-1-2-1-1- LEGEND: COL. 1: RANK. The ranks are obtained by sorting the fold library, by Z-SCORES, in decreasing order. Only the 15 structures that are most compatible to your sequence are shown. COL. 2: Z-SCORE. The z-scores are computed using the distribution of raw scores (not shown) of all folds. COL. 3: FOLD. Protein Data Bank codes for the coordinates of the 3D structures. COL. 4: LENGTHALI. The number of residues from your sequence that were aligned to the fold. COL. 5: % ID. Percentage of identical residues in the alignment. RELIABILITY OF THIS PREDICTION: With this method the confidence threshold is a z-score of 4.8 +- 1.0. YOUR HIGHEST SCORING FOLD IS ABOVE THIS THRESHOLD Below is the alignment of your sequence with the top hit structure. In the near future, all the alignments in a more readable format will be made available. bbbbbb hhhhhhhbbbbhh hhhhhhhhhhhhhhhbbbbbb YEILFSDETMNYADAGTYCQSRGMALVS.SAMRDSTMVKAILAFTEVKGH | | | | | ||| | || || WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSP...S bbbbb hhhhhhhhhhhhh bbb hhhhhhhhhhhh bbbbbbb bbbbb b bb bb DYWVGADNLQDGAYNFLW.NDGVSLPTDSDLWSPNEPSNPQSWQLCVQIW || | | | | | || | | || | YYWIGIRKVNN...VWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIY bbbbbbbbb bbbbb bbb bbbbb bb b bbbbbb SK....YNLLDDVGCGGARRVIC | | | | IKREKDVGMWNDERCSKKKLALC bbbbb bbbb 27% Additional information for your prediction can be found at the url: http://www.doe-mbi.ucla.edu/people/frsvr/preds/24402t0055/24402t0055.html p.s. if you need further information on this output, send an e-mail message to: fischer@mbi.ucla.edu