SERVERNAME: frsvr_SDP TARGET: T0054 PARAMETERS: excludefolds: 1kja 1hli include h3p2 URL: http://www.cs.bgu.ac.il/~dfischer/cafasp1/frsvr_SDP.t0054 SERVER'S URL: http://www.doe-mbi.ucla.edu/people/frsvr/submit.html RANK FOLD SCORE LENGTH_ALIGNMENT SEQ_ID% 1 1pp2l 4.68 112 25 2 1auoa 4.24 187 18 3 1poxa_183-365 4.00 161 22 4 1cgme 3.52 148 20 5 1mml 3.37 167 19 6 1hma 3.21 73 25 7 1rvea 3.09 183 19 8 2pcda 2.98 170 20 9 1scub_245-388 2.97 143 15 10 1lz1 2.76 118 24 11 1ar4a 2.74 180 17 12 1cfe 2.72 135 19 13 1bbha 2.68 129 22 14 3gapa_1-137 2.65 111 23 15 1icea 2.63 158 15 END The three-dimensional fold predicted for your amino acid sequence is in the table below. HERE I INCLUDE ONLY THE RESULTS OF THE gonnet+predss METHOD. THE OTHER RESULTS CAN BE FOUND AT THE URL (www page) SPECIFIED AT THE END OF THIS MESSAGE. Please cite: Fischer, D. and Eisenberg, D. Fold Recognition Using Sequence-Derived Predictions. Protein Science, 5, 947-955, 1996. * * * * N O T E * * * * PLEASE CONSULT ALSO THE RESULTS OF gonnet+predss+multi Your sequence was translated to: seq.seq Length: 202 December 30, 1998 09:44 Type: P Check: 7047 .. 1 MEIGFTFLDE IVHGVRWDAK YATWDNFTGK PVDGYEVNRI VGTYELAESL 51 LKAKELAATQ GYGLLLWDGY RPKRAVNCFM QWAAQPENNL TKESYYPNID 101 RTEMISKGYV ASKSSHSRGS AIDLTLYRLD TGELVPMGSR FDFMDERSHH 151 AANGISCNEA QNRRRLRSIM ENSGFEAYSL EWWHYVLRDE PYPNSYFDFP 201 VK NAME: t0054 FROM: dfischer@indigo.cs.bgu.ac.il BY YOUR REQUEST I HAVE NOT USED THE FOLLOWING FOLDS: 1an3b 1az7 1bd9a 1bg8a 1bl0a 1cdaa 1hli 1illg 1kja The method used for this prediction was: gonnet+predss . Most similar fold: 1pp2l CALCIUM-FREE PHOSPHOLIPASE A=2= (E.C.3.1.1.4) RANK Z-SCORE FOLD LENGTHALI %ID 1 4.68 1pp2l 112 25 1-70 alpha ; Phospholipase A2] 1-70-1-2-1-3-1- 2 4.24 1auoa 187 18 1998 3 4.00 1poxa_183-365 161 22 3-17 a/b ; Pyruvate oxidase and decarboxylase, middle domain] 3-17-1-1-2-1-2- 4 3.52 1cgme 148 20 1-20 alpha ; Four-helical up-and-down bundle] 1-20-5-1-2-1-1- 5 3.37 1mml 167 19 NA/RNA olymerases] 5-8 [; DNA/RNA polymerases] 5-8-1-2-1-1- 6 3.21 1hma 73 25 1-17 alpha ; HMG-box] 1-17-1-1-2-1- 7 3.09 1rvea 183 19 3-32 a/b ; Restriction endonucleases] 3-32-1-2-1-1-4- 8 2.98 2pcda 170 20 2-3 beta ; Prealbumin-like] 2-3-3-1-1-1-1- 9 2.97 1scub_245-388 143 15 3-11 a/b ; Flavodoxin-like] 3-11-3-1-2-1-1- 10 2.76 1lz1 118 24 4-2 (a+b) ; Lysozyme-like] 4-2-1-2-1-8- 11 2.74 1ar4a 180 17 1997 new ; X-RAY STRUCTURE ANALYSIS OF THE CAMBIALISTIC SUPER 12 2.72 1cfe 135 19 1997 new ; P14A, NMR, 20 STRUCTURES 13 2.68 1bbha 129 22 1-20 alpha ; Four-helical up-and-down bundle] 1-20-3-2-1-2-1- 14 2.65 3gapa_1-137 111 23 2-49 beta ; Double-stranded beta-helix] 2-49-2-1-1-1-2- 15 2.63 1icea 158 15 3-8 a/b ; Interleukin-1beta converting enzyme (a cysteine protease)] 3-8-1-1-1-1-1- LEGEND: COL. 1: RANK. The ranks are obtained by sorting the fold library, by Z-SCORES, in decreasing order. Only the 15 structures that are most compatible to your sequence are shown. COL. 2: Z-SCORE. The z-scores are computed using the distribution of raw scores (not shown) of all folds. COL. 3: FOLD. Protein Data Bank codes for the coordinates of the 3D structures. COL. 4: LENGTHALI. The number of residues from your sequence that were aligned to the fold. COL. 5: % ID. Percentage of identical residues in the alignment. RELIABILITY OF THIS PREDICTION: With this method the confidence threshold is a z-score of 4.8 +- 1.0. YOUR HIGHEST SCORING FOLD IS BELOW THIS THRESHOLD YOUR PREDICTION IS NOT RELIABLE. You may conclude that: IF the fold of your sequence is similar to one already observed, THEN: - Our method is not sensitive enough to assign a fold for your sequence, and/or - It may be contained within a larger fold, and/or - The fold of your sequence is not included in our library of folds. IF your sequence corresponds to a new, unobserved fold, THEN: - Our method reflects this by a below threshold score. Below is the alignment of your sequence with the top hit structure. In the near future, all the alignments in a more readable format will be made available. hhhhhhhhhhh bbbb hhhhhhhhhhh h LLKAKELAATQGYGLLLWDGYRPKRAVNCFMQWAAQPENNLTKESYYPNI ||| | | | | QFETLIMKIAGRSGLLWYSAYG......CYCGWGGH...GLPQDA....T hhhhhhhhhh hhhhh h h hhhhhhh bbbb bbbbbbb bbbb DRTEMISKGYVASKSSHSRGSAIDLTLYRLDTGELVPMGSRFDFMDERSH || | | | || | DRCCFVHD.CCYGKATDCNPKTVSYT.YSEENGEIICGG........... hhhhhhhh hhh b bbb bbbb hhhhhhhhhhhhhhh bhhhhhhh hh HAANGISCNEAQNRRRLRSIMENSGFEAYSLEWWHYV...LRDEPYP | | | | || | ...DDPCGTQICECDKAAAICFRDNIPSYDNKYWLFPPKDCREEPEP hhhhhhhhhhhhhhhhhh hhh hhh hhh 19% Additional information for your prediction can be found at the url: http://www.doe-mbi.ucla.edu/people/frsvr/preds/24503t0054/24503t0054.html p.s. if you need further information on this output, send an e-mail message to: fischer@mbi.ucla.edu